A Novel, Automated, and Highly Selective Phosphopeptide Enrichment for Phosphopeptide Identification and Phosphosite Localization
Aplikace | 2020 | Agilent TechnologiesInstrumentace
Příprava vzorků, LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
ZaměřeníProteomika
VýrobceAgilent Technologies
Klíčová slovaphosphopeptide, vveavnsdsdsefgipk, phosphopeptides, enrichment, yeast, peptide, enriched, assaymap, nonphosphopeptide, ecd, were, phosphorylation, phosphorylated, phosphosite, precursor, byonic, bravo, nta, peptides, nanodapter, sequence, cell, localization, agilent, site, charge, ems, ions, distinct, identified, mill, acquisition, using, hupo, nonphosphorylated, phosphosites, human, abundance, collision, yes, relative, iii, sample, spectrum, each, based, still, carbamidomethylation, deactivator, prot
Podobná PDF
Human Breast Cancer Cell Line Phosphoproteome Revealed by an Automated and Highly Selective Enrichment Workflow
2018|Agilent Technologies|Aplikace
Application Note Human Breast Cancer Cell Line Phosphoproteome Revealed by an Automated and Highly Selective Enrichment Workflow Authors Shuai Wu and Linfeng Wu Agilent Technologies, Inc. Santa Clara, CA, USA Introduction Phosphopeptide enrichment has been a challenging task in that…
Klíčová slova
phosphopeptide, phosphopeptideenrichment, enrichmentphosphopeptides, phosphopeptidesfound, foundphosphomix, phosphomixyield, yieldtklitqlrdak, tklitqlrdakimac, imacpeptides, peptidesnta, ntananodapter, nanodapterunenriched, unenrichedheavy, heavyassaymap, assaymaplight
Agilent AssayMAP Bravo Technology Enables Reproducible Automated Phosphopeptide Enrichment from Complex Mixtures Using High‑Capacity Fe(III)‑NTA Cartridges
2016|Agilent Technologies|Aplikace
Agilent AssayMAP Bravo Technology Enables Reproducible Automated Phosphopeptide Enrichment from Complex Mixtures Using High‑Capacity Fe(III)‑NTA Cartridges Application Note Automated Peptide Sample Preparation for LC/MS Authors Abstract Jason D. Russell and Steve Murphy Immobilized metal affinity chromatography (IMAC) using a nitrilotriacetic…
Klíčová slova
phosphopeptide, phosphopeptidephosphopeptides, phosphopeptidesenrichment, enrichmentassaymap, assaymapnta, ntaiii, iiiselectivity, selectivityidentifications, identificationscartridges, cartridgescasein, caseinimmobilized, immobilizeddistinct, distinctsample, sampleimac, imaccartridge
Examining the Structural Influence of Site-Specific Phosphorylation by Ion Mobility Mass Spectrometry
2019|Agilent Technologies|Aplikace
Application Note Biologics Examining the Structural Influence of Site-Specific Phosphorylation by Ion Mobility Mass Spectrometry Authors Rebecca S. Glaskin, Caroline S. Chu, and Dawn M. Stickle Agilent Technologies, Inc. Abstract This application note describes an automated workflow for the analysis…
Klíčová slova
casein, caseindrift, driftphosphopeptide, phosphopeptidevnelskdigsestedqamedik, vnelskdigsestedqamedikfqseeqqqtedelqdk, fqseeqqqtedelqdkccs, ccscharge, chargephosphorylation, phosphorylationnavpitptlnreqlstseenskk, navpitptlnreqlstseenskkmass, masssequence, sequenceekvnelskdigsestedqamedik, ekvnelskdigsestedqamedikntppsqhshpsiqhsper, ntppsqhshpsiqhsperpeptides, peptidesrspypsrsr
Evaluation of search engines for phosphopeptide identification and quantitation
2016|Thermo Fisher Scientific|Postery
Poster Note 64793 Evaluation of search engines for phosphopeptide identification and quantitation Evaluation of of search searchengines enginesfor forphosphope phosphop Evaluation Xiaoyue Jiang1, David Horn1, Ryan Bomgarden2 ,Tara Schroeder3, Rosa Viner1, Andreas FR Huhmer1 Thermo Fisher Scientific, San Jose, CA;…
Klíčová slova
phosphopeptide, phosphopeptidecid, cidethcd, ethcdmsa, msahcd, hcdfragmentation, fragmentationsearch, searchidentifications, identificationsphosphopeptides, phosphopeptidesmaxquant, maxquantbyonic, byonicsequest, sequestengines, enginesproteome, proteomemascot