Selective and sensitive quantification of glucagon and glucagon-related peptide hormones in human plasma using conventional LC/MS/MS
Postery | 2016 | ShimadzuInstrumentace
LC/MS, LC/MS/MS, LC/QQQ
ZaměřeníKlinická analýza
VýrobceShimadzu
Klíčová slovaglucagon, hormones, plasma, aqdfvqwlmnt, peptide, fasting, casual, hsqgtftsdyskyldsrr, related, conventional, selective, human, sensitive, quantification, secretion, insulin, cocktail, endogenous, krnrnnia, rslqdteeksrsfsasqadplsdpdqmnedkr, protease, using, healthy, mrm, volunteer, blood, area, curve, inhibitor, hormone, mini, mobile, mpgf, tube, grpp, oxyntomodulin, protein, min, containing, cid, chromatogram, phase, cytokines, amino, pancreas, level, homology, llod, peptides, flow
Podobná PDF
Selective and sensitive quantification of glucagon in human plasma using microflow LC/Q-TOF MS
2020|Shimadzu|Postery
TP 473 Selective and sensitive quantification of glucagon in human plasma using microflow LC/Q-TOF MS Tomoya Kudo, Wataru Fukui, and Toshiya Matsubara Shimadzu Corporation. 1, Nishinokyo-Kuwabaracho Nakagyo-ku, Kyoto 604–8511, Japan 1. Overview H S Q G T F T In…
Klíčová slova
glucagon, glucagonaqdfvqwlmnt, aqdfvqwlmntmicroflow, microflowhsqgtftsdyskyldsrr, hsqgtftsdyskyldsrrhormones, hormonesmicro, microgrpp, grppkrnrnnia, krnrnniaoxyntomodulin, oxyntomodulinrslqdteeksrsfsasqadplsdpdqmnedkr, rslqdteeksrsfsasqadplsdpdqmnedkrsemi, semipeptide, peptidecondition, conditiontof, tofproglucagon
PEPTIDE AND PROTEIN BIOANALYSIS
2016|Waters|Příručky
[ APPLICATION NOTEBOOK ] PEPTIDE AND PROTEIN BIOANALYSIS [ OUR SCIENTISTS ] Yun Alelyunas, PhD Before coming to Waters in 2012, Yun Alelyunas was a principal scientist and team leader at AstraZeneca for 20 years where she was involved in…
Klíčová slova
ionkey, ionkeypeptide, peptideplasma, plasmaquantification, quantificationhuman, humanarea, areainsulin, insulinxevo, xevoprotein, proteinuplc, uplcpeptides, peptidesmrm, mrmproteinworks, proteinworksantibody, antibodyusing
ionkey/MS - APPLICATION COMPENDIUM
2016|Waters|Příručky
[ ion key / MS ] APPLICATION COMPENDIUM Dear Colleague, The 2014 introduction of the ionKey/MS System was a turning point for LC-MS. The promise of increased levels of sensitivity from smaller sample sizes was finally a reality. We were…
Klíčová slova
ionkey, ionkeyikey, ikeyuplc, uplcsystem, systemplasma, plasmasensitivity, sensitivityhuman, humanion, ionusing, usingmobility, mobilityarea, areadevice, deviceassay, assayseparation, separationquantification
Development of a High Sensitivity SPE-LC-MS/MS Assay for the Quantification of Glucagon in Human Plasma Using the ionKey/MS System
2016|Waters|Aplikace
Development of a High Sensitivity SPE-LC-MS/MS Assay for the Quantification of Glucagon in Human Plasma Using the ionKey/MS System Mary E. Lame, Erin E. Chambers, Sukhdev S. Bangar, and Kenneth J. Fountain Waters Corporation, Milford, MA, USA A P P…
Klíčová slova
glucagon, glucagonassay, assayionkey, ionkeyplasma, plasmaspe, spehuman, humansensitivity, sensitivityquantification, quantificationdevelopment, developmentikey, ikeyarea, areahigh, highhormone, hormoneexogenous, exogenousaccurately
