Selective and sensitive quantification of glucagon in human plasma using microflow LC/Q-TOF MS
Postery | 2020 | ShimadzuInstrumentace
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
ZaměřeníKlinická analýza
VýrobceShimadzu
Klíčová slovaglucagon, aqdfvqwlmnt, microflow, hsqgtftsdyskyldsrr, hormones, grpp, krnrnnia, oxyntomodulin, rslqdteeksrsfsasqadplsdpdqmnedkr, micro, semi, peptide, condition, tof, plasma, proglucagon, trap, off, lcms, using, cytokines, accuracy, analytical, pancreas, homology, peptides, llod, hamper, secretion, flow, neb, mikros, mass, gas, cocktail, evolute, grass, impaired, gut, rate, esi, protease, bioactive, hydrate, sensitive, curve, quantification, biotage, inhibitor, quantitation
Podobná PDF
Selective and sensitive quantification of glucagon and glucagon-related peptide hormones in human plasma using conventional LC/MS/MS
2016|Shimadzu|Postery
PO-CON1631E Selective and sensitive quantification of glucagon and glucagon-related peptide hormones in human plasma using conventional LC/MS/MS ASMS 2016 ThP-494 Toshiya Matsubara1,2, Norihide Yokoi2, Ritsuko Hoshikawa2, Ichiro Hirano1, Susumu Seino2 Shimadzu Corporation. 1, Nishinokyo-Kuwabaracho Nakagyo-ku, Kyoto 604–8511, Japan. 2 Kobe…
Klíčová slova
glucagon, glucagonhormones, hormonesplasma, plasmaaqdfvqwlmnt, aqdfvqwlmntpeptide, peptidefasting, fastingcasual, casualhsqgtftsdyskyldsrr, hsqgtftsdyskyldsrrrelated, relatedconventional, conventionalselective, selectivehuman, humansensitive, sensitivequantification, quantificationinsulin
ionkey/MS - APPLICATION COMPENDIUM
2016|Waters|Příručky
[ ion key / MS ] APPLICATION COMPENDIUM Dear Colleague, The 2014 introduction of the ionKey/MS System was a turning point for LC-MS. The promise of increased levels of sensitivity from smaller sample sizes was finally a reality. We were…
Klíčová slova
ionkey, ionkeyikey, ikeyuplc, uplcsystem, systemplasma, plasmasensitivity, sensitivityhuman, humanion, ionusing, usingmobility, mobilityarea, areadevice, deviceassay, assayseparation, separationquantification
PEPTIDE AND PROTEIN BIOANALYSIS
2016|Waters|Příručky
[ APPLICATION NOTEBOOK ] PEPTIDE AND PROTEIN BIOANALYSIS [ OUR SCIENTISTS ] Yun Alelyunas, PhD Before coming to Waters in 2012, Yun Alelyunas was a principal scientist and team leader at AstraZeneca for 20 years where she was involved in…
Klíčová slova
ionkey, ionkeypeptide, peptideplasma, plasmaquantification, quantificationhuman, humanarea, areaxevo, xevoinsulin, insulinprotein, proteinuplc, uplcpeptides, peptidesmrm, mrmproteinworks, proteinworksantibody, antibodyusing
Shimadzu Microow Liquid Chromatography Mass Spectrometry System Nexera Mikros
2020|Shimadzu|Brožury a specifikace
C146-E350B Microflow Liquid Chromatography Mass Spectrometry System Nexera Mikros M i c r o: Above and Beyond Nano T h e High Sensitivit y You E x p e c t from a Low Flow Sys tem with the Ruggedness…
Klíčová slova
mikros, mikrosmicroflow, microflownexera, nexerashim, shimbonded, bondedmicro, micropack, packplonas, plonasphase, phaseverapamil, verapamilpolar, polarsystem, systemdiameter, diameterpart, partmin
