On-line Comprehensive RP-LC×RP-LC/IT-TOF for the Analysis of Proteome Isoforms
Aplikace | 2015 | ShimadzuInstrumentace
LC/TOF, LC/MS, LC/MS/MS, 2D-LC, LC/IT
ZaměřeníProteomika
VýrobceShimadzu
Klíčová slovacasein, dephosphorylated, tryptic, tof, mixture, peptidemass, tvdmestevftk, digest, lcms, phase, dimension, expasy, peptides, plot, error, peptide, reversed, tenth, phospho, afterwards, five, comprehensive, ups, column, envelope, isoforms, contour, silico, promise, gradient, meaningful, gram, shown, oven, monoisotopic, digests, recombinant, mobile, were, amu, proteome, performed, pda, deconvoluted, predicted, far, characterized, without, native, rate
Podobná PDF
Application Handbook Liquid Chromatography
2016|Shimadzu|Příručky
Application Handbook Liquid Chromatography Introduction HPLC, UHPLC as well as SFC systems are able to quantitatively analyze substances in mixtures containing multiple ingredients by separating and detecting target substances. They are used to separate, quantify, qualify or purify single components…
Klíčová slova
sfe, sfeflowrate, flowrateprominence, prominencenews, newsnexera, nexeraanalysis, analysiscolumn, columnmin, minextraction, extractionsfc, sfcwithout, withoutpeaks, peaksmau, maumobile, mobilesystem
Analysis of E.coli Tryptic Digest and Intact Protein Using the Agilent 1290 Infi nity 2D-LC Solution with Diode Array Detection and Q-TOF LC/MS
2014|Agilent Technologies|Aplikace
Analysis of E.coli Tryptic Digest and Intact Protein Using the Agilent 1290 Infinity 2D-LC Solution with Diode Array Detection and Q-TOF LC/MS Application Note Proteomics & Protein Sciences Authors Abstract Gerd Vanhoenacker1, Koen Sandra1,2 , 1,2 1 Isabel Vandenheede ,…
Klíčová slova
flow, flowdimension, dimensionrplc, rplcfirst, firstprotein, proteincounts, countsmodulation, modulationdad, dadsecond, secondpeak, peakmass, massdlvesapaalk, dlvesapaalkvgeeveivgik, vgeeveivgiksalt, salttryptic
Examining the Structural Influence of Site-Specific Phosphorylation by Ion Mobility Mass Spectrometry
2019|Agilent Technologies|Aplikace
Application Note Biologics Examining the Structural Influence of Site-Specific Phosphorylation by Ion Mobility Mass Spectrometry Authors Rebecca S. Glaskin, Caroline S. Chu, and Dawn M. Stickle Agilent Technologies, Inc. Abstract This application note describes an automated workflow for the analysis…
Klíčová slova
casein, caseindrift, driftphosphopeptide, phosphopeptidevnelskdigsestedqamedik, vnelskdigsestedqamedikfqseeqqqtedelqdk, fqseeqqqtedelqdkccs, ccscharge, chargephosphorylation, phosphorylationnavpitptlnreqlstseenskk, navpitptlnreqlstseenskkmass, massekvnelskdigsestedqamedik, ekvnelskdigsestedqamedikntppsqhshpsiqhsper, ntppsqhshpsiqhsperpeptides, peptidessequence, sequencerspypsrsr
Advancing Host Cell Protein Analyses Through the Combined Use of Microscale 2D RP/RP with CSH C18 and Ion Mobility Enabled MS Detection
2014|Waters|Aplikace
Advancing Host Cell Protein Analyses Through the Combined Use of Microscale 2D RP/RP with CSH C18 and Ion Mobility Enabled MS Detection Matthew A. Lauber, Catalin E. Doneanu, Stephan M. Koza, Weibin Chen, and Kenneth J. Fountain Waters Corporation, Milford,…
Klíčová slova
uplc, uplcmicroscale, microscaleacquity, acquityplgs, plgsprotein, proteinmab, mabasm, asmhcp, hcpclass, classdigest, digestprecursor, precursortvm, tvmhost, hosthcps, hcpsuniprot
