Agilent 6560 Ion Mobility Q-TOF LC/MS SystemBrožury a specifikace | 2017 | Agilent TechnologiesInstrumentaceIontová mobilita, LC/TOF, LC/HRMS, LC/MS, LC/MS/MSVýrobceAgilent TechnologiesKlíčová slovadrift, ion, mobility, funnel, region, separation, ccs, charge, you, analysisanalysis, panomics, protein, peptides, extracted, empirical, mass, data, dimension, agilent, effectively, cross, glycomics, melezitose, conformations, imagine, molecular, molecules, raffinose, difference, dense, detect, proteomics, capacity, orthogonal, mapping, matters, conformational, collision, pan, individual, resolve, conformation, research, you’re, tool, all, time, omics, viewing, ions
Podobná PDF
Examining the Structural Influence of Site-Specific Phosphorylation by Ion Mobility Mass Spectrometry
2019|Agilent Technologies|Aplikace
Application NoteBiologicsExamining the Structural Influenceof Site-Specific Phosphorylation byIon Mobility Mass SpectrometryAuthorsRebecca S. Glaskin,Caroline S. Chu, andDawn M. StickleAgilent Technologies, Inc.AbstractThis application note describes an automated workflow for the analysis of proteinphosphorylation from sample preparation with phosphopeptide enrichment toanalysis by ion...
Klíčová slova
casein, caseindrift, driftphosphopeptide, phosphopeptidevnelskdigsestedqamedik, vnelskdigsestedqamedikfqseeqqqtedelqdk, fqseeqqqtedelqdkccs, ccscharge, chargephosphorylation, phosphorylationnavpitptlnreqlstseenskk, navpitptlnreqlstseenskkmass, masssequence, sequencepeptides, peptidesekvnelskdigsestedqamedik, ekvnelskdigsestedqamedikntppsqhshpsiqhsper, ntppsqhshpsiqhsperphosphopeptides
The Agilent Ion Mobility Q-TOF MassSpectrometer SystemTechnical OverviewAuthorsRuwan Kurulugama, Ken Imatani, andThe Agilent Ion Mobility Q-TOF Mass SpectrometerSystemLester Taylor•Delivers an added dimension of separationAgilent Technologies, Inc.•Provides direct measurement of accurate collision cross sectionsSanta Clara CA•Preserves structural characteristics of molecular conformations•Expands...
Klíčová slova
drift, driftmobility, mobilityion, ionfunnel, funnelcross, crossseparation, separationfield, fieldcollision, collisionions, ionsstructural, structuraltube, tubeagilent, agilentuniform, uniformsection, sectionpreservation
ADD A NEW DIMENSION TO YOUR RESEARCH WITH THE AGILENT 6560 ION MOBILITY Q-TOF LC/MS
2015|Agilent Technologies|Technické články
ADD A NEW DIMENSION TO YOURRESEARCH WITH THE AGILENT 6560 IONMOBILITY Q-TOF LC/MSThe Measure of ConfidenceKen ImataniAgilent Q-TOF LC/MSProduct ManagerDavid Wong, Ph.D.Senior Application ScientistApplications HighlightsThe Agilent 6560 Ion Mobility Q-TOF LC/MS system is the first commerciallyavailable uniform field ion mobility...
Klíčová slova
drift, driftcounts, countscharge, chargemobility, mobilitymass, massexamples, examplesconformations, conformationsspecificity, specificityspectrum, spectrumtime, timeion, iondifucohexaose, difucohexaosepreserve, preservestructural, structurallacto
GC-APCI IMS of DieselApplication NoteEnergy and ChemicalsAuthorsAbstractSheher Bano Mohsin, David Wong,This Application Note describes the use of ion mobility and high-resolutionand F. Robert LeyGC/MS for profiling sulfur compounds in a very complex sample such as dieselAgilent Technologies, Inc.fuel. The analysis...
Klíčová slova
kendrick, kendrickmass, massdrift, driftdiesel, dieselmobility, mobilitydefect, defection, ionsulfur, sulfurdibenzothiophenes, dibenzothiophenesapci, apcifunnel, funnelseries, seriescompounds, compoundsims, imstof