Agilent 6560 Ion Mobility Q-TOF LC/MS System | LabRulez LCMS
 

Podobná PDF

Toggle
Application NoteBiologicsExamining the Structural Influenceof Site-Specific Phosphorylation byIon Mobility Mass SpectrometryAuthorsRebecca S. Glaskin,Caroline S. Chu, andDawn M. StickleAgilent Technologies, Inc.AbstractThis application note describes an automated workflow for the analysis of proteinphosphorylation from sample preparation with phosphopeptide enrichment toanalysis by ion...
Klíčová slova
casein, caseindrift, driftphosphopeptide, phosphopeptidevnelskdigsestedqamedik, vnelskdigsestedqamedikfqseeqqqtedelqdk, fqseeqqqtedelqdkccs, ccscharge, chargephosphorylation, phosphorylationnavpitptlnreqlstseenskk, navpitptlnreqlstseenskkmass, masssequence, sequencepeptides, peptidesekvnelskdigsestedqamedik, ekvnelskdigsestedqamedikntppsqhshpsiqhsper, ntppsqhshpsiqhsperphosphopeptides
The Agilent Ion Mobility Q-TOF Mass Spectrometer System
2021|Agilent Technologies|Technické články
The Agilent Ion Mobility Q-TOF MassSpectrometer SystemTechnical OverviewAuthorsRuwan Kurulugama, Ken Imatani, andThe Agilent Ion Mobility Q-TOF Mass SpectrometerSystemLester Taylor•Delivers an added dimension of separationAgilent Technologies, Inc.•Provides direct measurement of accurate collision cross sectionsSanta Clara CA•Preserves structural characteristics of molecular conformations•Expands...
Klíčová slova
drift, driftmobility, mobilityion, ionfunnel, funnelcross, crossseparation, separationfield, fieldcollision, collisionions, ionsstructural, structuraltube, tubeagilent, agilentuniform, uniformsection, sectionpreservation
ADD A NEW DIMENSION TO YOURRESEARCH WITH THE AGILENT 6560 IONMOBILITY Q-TOF LC/MSThe Measure of ConfidenceKen ImataniAgilent Q-TOF LC/MSProduct ManagerDavid Wong, Ph.D.Senior Application ScientistApplications HighlightsThe Agilent 6560 Ion Mobility Q-TOF LC/MS system is the first commerciallyavailable uniform field ion mobility...
Klíčová slova
drift, driftcounts, countscharge, chargemobility, mobilitymass, massexamples, examplesconformations, conformationsspecificity, specificityspectrum, spectrumtime, timeion, iondifucohexaose, difucohexaosepreserve, preservestructural, structurallacto
GC-APCI IMS of Diesel
2015|Agilent Technologies|Aplikace
GC-APCI IMS of DieselApplication NoteEnergy and ChemicalsAuthorsAbstractSheher Bano Mohsin, David Wong,This Application Note describes the use of ion mobility and high-resolutionand F. Robert LeyGC/MS for profiling sulfur compounds in a very complex sample such as dieselAgilent Technologies, Inc.fuel. The analysis...
Klíčová slova
kendrick, kendrickmass, massdrift, driftdiesel, dieselmobility, mobilitydefect, defection, ionsulfur, sulfurdibenzothiophenes, dibenzothiophenesapci, apcifunnel, funnelseries, seriescompounds, compoundsims, imstof
 

Podobná PDF

Toggle
Application NoteBiologicsExamining the Structural Influenceof Site-Specific Phosphorylation byIon Mobility Mass SpectrometryAuthorsRebecca S. Glaskin,Caroline S. Chu, andDawn M. StickleAgilent Technologies, Inc.AbstractThis application note describes an automated workflow for the analysis of proteinphosphorylation from sample preparation with phosphopeptide enrichment toanalysis by ion...
Klíčová slova
casein, caseindrift, driftphosphopeptide, phosphopeptidevnelskdigsestedqamedik, vnelskdigsestedqamedikfqseeqqqtedelqdk, fqseeqqqtedelqdkccs, ccscharge, chargephosphorylation, phosphorylationnavpitptlnreqlstseenskk, navpitptlnreqlstseenskkmass, masssequence, sequencepeptides, peptidesekvnelskdigsestedqamedik, ekvnelskdigsestedqamedikntppsqhshpsiqhsper, ntppsqhshpsiqhsperphosphopeptides
The Agilent Ion Mobility Q-TOF Mass Spectrometer System
2021|Agilent Technologies|Technické články
The Agilent Ion Mobility Q-TOF MassSpectrometer SystemTechnical OverviewAuthorsRuwan Kurulugama, Ken Imatani, andThe Agilent Ion Mobility Q-TOF Mass SpectrometerSystemLester Taylor•Delivers an added dimension of separationAgilent Technologies, Inc.•Provides direct measurement of accurate collision cross sectionsSanta Clara CA•Preserves structural characteristics of molecular conformations•Expands...
Klíčová slova
drift, driftmobility, mobilityion, ionfunnel, funnelcross, crossseparation, separationfield, fieldcollision, collisionions, ionsstructural, structuraltube, tubeagilent, agilentuniform, uniformsection, sectionpreservation
ADD A NEW DIMENSION TO YOURRESEARCH WITH THE AGILENT 6560 IONMOBILITY Q-TOF LC/MSThe Measure of ConfidenceKen ImataniAgilent Q-TOF LC/MSProduct ManagerDavid Wong, Ph.D.Senior Application ScientistApplications HighlightsThe Agilent 6560 Ion Mobility Q-TOF LC/MS system is the first commerciallyavailable uniform field ion mobility...
Klíčová slova
drift, driftcounts, countscharge, chargemobility, mobilitymass, massexamples, examplesconformations, conformationsspecificity, specificityspectrum, spectrumtime, timeion, iondifucohexaose, difucohexaosepreserve, preservestructural, structurallacto
GC-APCI IMS of Diesel
2015|Agilent Technologies|Aplikace
GC-APCI IMS of DieselApplication NoteEnergy and ChemicalsAuthorsAbstractSheher Bano Mohsin, David Wong,This Application Note describes the use of ion mobility and high-resolutionand F. Robert LeyGC/MS for profiling sulfur compounds in a very complex sample such as dieselAgilent Technologies, Inc.fuel. The analysis...
Klíčová slova
kendrick, kendrickmass, massdrift, driftdiesel, dieselmobility, mobilitydefect, defection, ionsulfur, sulfurdibenzothiophenes, dibenzothiophenesapci, apcifunnel, funnelseries, seriescompounds, compoundsims, imstof
 

Mohlo by Vás zajímat

Overcoming the challenges of liquid chromatography method transfer: A CDMO perspective

Technické články
| 2022 | Thermo Fischer Scientific
Instrumentace
HPLC
Výrobce
Thermo Fischer Scientific
Zaměření
---

Method for the determination of 431 Residual Pesticides in Honey using LCMS-8050 and GCMS-TQ8040 NX

Aplikace
| 2022 | Shimadzu
Instrumentace
GC/MSD, GC/MS/MS, GC/QQQ, LC/MS, LC/MS/MS, LC/QQQ
Výrobce
Shimadzu
Zaměření
Potraviny a zemědělství

ASMS: IMPROVEMENTS IN SENSITIVITY, QUANTITATIVE LINEARITY, AND ROBUSTNESS USING A MODIFIED BENCH-TOP QUADRUPOLE ORTHOGONAL TIME-OF-FLIGHT MASS SPECTROMETER (Q-TOF MS)

Postery
| 2022 | Waters
Instrumentace
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
Výrobce
Waters
Zaměření
---

Determination of Per and Polyfluoroalkyl Substances in Soils Using Carbon S SPE by LC/MS/MS

Aplikace
| 2022 | Agilent Technologies
Instrumentace
Příprava vzorků, Spotřební materiál, LC/MS, LC/MS/MS, LC/QQQ
Výrobce
Agilent Technologies
Zaměření
Životní prostředí

ASTM D4327-03 Compliant Analysis of Anions in Wastewater

Aplikace
| 2022 | Shimadzu
Instrumentace
Iontová chromatografie
Výrobce
Shimadzu
Zaměření
Životní prostředí
 

Mohlo by Vás zajímat

Overcoming the challenges of liquid chromatography method transfer: A CDMO perspective

Technické články
| 2022 | Thermo Fischer Scientific
Instrumentace
HPLC
Výrobce
Thermo Fischer Scientific
Zaměření
---

Method for the determination of 431 Residual Pesticides in Honey using LCMS-8050 and GCMS-TQ8040 NX

Aplikace
| 2022 | Shimadzu
Instrumentace
GC/MSD, GC/MS/MS, GC/QQQ, LC/MS, LC/MS/MS, LC/QQQ
Výrobce
Shimadzu
Zaměření
Potraviny a zemědělství

ASMS: IMPROVEMENTS IN SENSITIVITY, QUANTITATIVE LINEARITY, AND ROBUSTNESS USING A MODIFIED BENCH-TOP QUADRUPOLE ORTHOGONAL TIME-OF-FLIGHT MASS SPECTROMETER (Q-TOF MS)

Postery
| 2022 | Waters
Instrumentace
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
Výrobce
Waters
Zaměření
---

Determination of Per and Polyfluoroalkyl Substances in Soils Using Carbon S SPE by LC/MS/MS

Aplikace
| 2022 | Agilent Technologies
Instrumentace
Příprava vzorků, Spotřební materiál, LC/MS, LC/MS/MS, LC/QQQ
Výrobce
Agilent Technologies
Zaměření
Životní prostředí

ASTM D4327-03 Compliant Analysis of Anions in Wastewater

Aplikace
| 2022 | Shimadzu
Instrumentace
Iontová chromatografie
Výrobce
Shimadzu
Zaměření
Životní prostředí
Další projekty
Sledujte nás
Další informace
WebinářeO násKontaktujte násPodmínky užití

LabRulez s.r.o. Všechna práva vyhrazena.