Method Development Tools for More Efficient Screening of Biopharmaceutical Method Conditions Using the ACQUITY Arc Bio SystemPart 1 of 2: Screening Multiple RPLC Columns for High Throughput Analysis
Aplikace | 2020 | WatersInstrumentace
LC/MS, LC/SQ
ZaměřeníFarmaceutická analýza
VýrobceWaters
Klíčová slovacortecs, csh, acquity, arc, beh, aph, peptide, bio, chemistries, intensity, mab, biopharmaceutical, method, aux, peptides, qda, column, conditions, efficient, valve, screening, switching, tools, nist, retention, can, empower, detector, tfa, columns, note, more, massprep, application, development, mass, four, digestion, angiotensin, how, system, min, designated, screened, capacity, time, unit, tryptic, dyfpepvtvswnsgaltsgvhtfpavlqssgl, managerauxiliary
Podobná PDF
Selecting a Reversed-Phase Column for the Peptide Mapping Analysis of a Biotherapeutic Protein
2017|Waters|Aplikace
[ APPLICATION NOTE ] Selecting a Reversed-Phase Column for the Peptide Mapping Analysis of a Biotherapeutic Protein Stephan M. Koza and Erin E. Chambers Waters Corporation, Milford, MA, USA APPLICATION BENEFITS ■■ ■■ Side-by-side performance of ten The peptide mapping…
Klíčová slova
peptide, peptidemapping, mappingbiotherapeutic, biotherapeuticreversed, reversedpeptides, peptidesselecting, selectingprotein, proteinangiotensin, angiotensintfa, tfaxic, xicphase, phasemassprep, masspreptryptic, trypticcolumn, columnparticle
METHOD DEVELOPMENT - The Path to Successful Drug Development Starts with Purposeful Method Development
2014|Waters|Příručky
[ APPLICATION NOTEBOOK ] METHOD DEV ELOPMENT The Path to Successful Drug Development Starts with Purposeful Method Development [ INTRODUCTION ] T he Path to Successful Drug Development Starts with Purposeful Method Development The goal of method development in pharmaceutical…
Klíčová slova
uplc, uplcacquity, acquitydevelopment, developmentziprasidone, ziprasidonemethod, methodwaters, waterssystematic, systematiccolumn, columnhss, hssclass, classusing, usingparoxetine, paroxetineqda, qdametformin, metformintranslation
INCREASE SPEED, SENSITIVITY, AND RESOLUTION WITH UPLC COLUMN TECHNOLOGY
2018|Waters|Brožury a specifikace
[ UPLC COLUMNS ] INCREASE SPEED, SENSITIVITY, AND RESOLUTION WITH UPLC COLUMN TECHNOLOGY 1 [ UPLC COLUMNS ] Performance Matters UltraPerformance Liquid Chromatography (UPLC®) combines the advances made in both instrumentation and column technology that enables you, the analytical scientist,…
Klíčová slova
uplc, uplchss, hssvanguard, vanguardphenyl, phenylparticle, particleacquity, acquityproprietary, proprietarycolumns, columnscortecs, cortecscsh, cshcolumn, columnpass, passhilic, hiliclar, larbeh
Synthetic Peptide Impurity Analysis on Waters Reversed-Phase Columns
2018|Waters|Aplikace
[ APPLICATION NOTE ] Synthetic Peptide Impurity Analysis on Waters Reversed-Phase Columns Hua Yang, Stephan Koza, Bill Warren, and Weibin Chen Waters Corporation, Milford, MA, USA APPLICATION BENEFITS ■■ ■■ Guidance behind selecting an Peptides are gaining more and more…
Klíčová slova
peptide, peptideimpurity, impuritysynthetic, syntheticceruletide, ceruletidecolumns, columnscsh, cshreversed, reversedwaters, watersinsertion, insertionputative, putativephase, phaseidentity, identitynote, noteretentivity, retentivitymass