How to Maximize Bioanalytical Performance of Fc-Fusion Proteins: Practical Sample Preparation and LC-MS/MS Workflows for Dulaglutide Quantification from Plasma
Aplikace | 2020 | WatersInstrumentace
Příprava vzorků, Spotřební materiál, LC/MS, LC/MS/MS, LC/QQQ
ZaměřeníKlinická analýza
VýrobceWaters
Klíčová slovahgegtftsdvssyleeqaak, glpssiek, dulaglutide, proteinworks, peptide, lqc, accuracy, hgeg, rsd, hqc, lloq, digestion, uplc, statistics, express, hmqc, superblock, affinity, glps, lmqc, peptides, note, acquity, digest, capture, spe, application, protein, auto, biotinylated, surrogate, quanrecovery, xevo, mqc, mcx, curve, quantification, plus, rat, beads, oasis, optimization, preparation, dpevqfnwyvdgvevhnaktkpreeqfnstyr, eskygppcppcpapeaa, ggpsvflfppkpkdtlmisrtpevtcvvvdvsqe, ggsggggsggggsa, gsfflysrltvdksrwqegnvfscsvmhealhn, hgegtftsdvssyleeqaakefiawlvkggggg, hytqkslslslg
Podobná PDF
Developing a Quantitative Surrogate Peptide Assay – Peptide mapping through MRM Optimization for Measuring Dulaglutide in a Rat PK Study
2020|Waters|Aplikace
Application Note Developing a Quantitative Surrogate Peptide Assay – Peptide mapping through MRM Optimization for Measuring Dulaglutide in a Rat PK Study Caitlin Dunning, Mark Wrona Waters Corporation Abstract Development of fusion protein therapeutics, such as dulaglutide (TRULICITYTM), is rising…
Klíčová slova
dulaglutide, dulaglutideskyline, skylinemasslynx, masslynxpeptide, peptidemrm, mrmpeptides, peptidesrat, ratoptimization, optimizationmapping, mappingvia, viaidentification, identificationsurrogate, surrogatedigested, digestedproteinworks, proteinworksquantitative
Accurate and Sensitive LC-MS/MS Quantification of Adalimumab in Serum/Plasma: Impact of Sample Preparation on Method Performance
2018|Waters|Aplikace
[ APPLICATION NOTE ] Accurate and Sensitive LC-MS/MS Quantification of Adalimumab in Serum/Plasma: Impact of Sample Preparation on Method Performance Caitlin Dunning, Mary Lame, Steven Calciano, and Kelly Doering Waters Corporation, Milford, MA, USA APPLICATION BENEFITS ■■ ■■ Speed and…
Klíčová slova
adalimumab, adalimumabserum, serumglewvsaitwnsghidyadsvegr, glewvsaitwnsghidyadsvegrquantification, quantificationnylawyqqkpgk, nylawyqqkpgkproteinworks, proteinworksapytfgqgtk, apytfgqgtkplasma, plasmaprotein, proteinspe, spepeptide, peptideaccurate, accuratedigestion, digestiondigest, digestsensitive
Automating Sample Preparation Workflows for Hybrid LC-MS/MS Bioanalysis of Protein Therapeutics: Quantification of Etanercept Using Affinity Purification and Digestion
2019|Waters|Aplikace
[ APPLICATION NOTE ] Automating Sample Preparation Workflows for Hybrid LC-MS/MS Bioanalysis of Protein Therapeutics: Quantification of Etanercept Using Affinity Purification and Digestion Paula Orens and Mary Lame Waters Corporation, Milford, MA, USA APPLICATION BENEFITS INTRODUCTION Automating a hybrid LC-MS/MS…
Klíčová slova
protein, proteinautomating, automatingbioanalysis, bioanalysishybrid, hybridtherapeutics, therapeuticsautomated, automatedictcrpgwycalsk, ictcrpgwycalskworkflows, workflowsimmunoaffinity, immunoaffinitypreparation, preparationpurification, purificationetanercept, etanerceptmanual, manualnormalized, normalizedraw
Triple Quadrupole Mass Spectrometry (Xevo TQ-XS) for the Quantification of Monoclonal Antibody Light Chains in Plasma
2019|Waters|Aplikace
[ APPLICATION NOTE ] Triple Quadrupole Mass Spectrometry (Xevo TQ-XS) for the Quantification of Monoclonal Antibody Light Chains in Plasma Caitlin M. Dunning, Mary Lame, and Mark Wrona Waters Corporation, Milford, MA, USA APPLICATION BENEFITS ■ ■ Fast, reproducible, and…
Klíčová slova
chains, chainslight, lightquantification, quantificationadalimumab, adalimumabxevo, xevomab, mabmonoclonal, monoclonaltriple, tripleantibody, antibodypolyphenyl, polyphenylsubunit, subunitquadrupole, quadrupolebioresolve, bioresolvealkylation, alkylationplasma
