Obnova hesla
Obnova hesla

Confident peptide mapping and disulfide bond analysis of an IgG2 monoclonal antibodyAplikace | 2020 | Thermo Fischer ScientificInstrumentace
Proteomika, Klinická analýza
Thermo Fischer Scientific
Klíčová slova
interchain, disulfide, peptide, mapping, kccvecppcpappvagpsvflfppkpk, ptms, intrachain, kingfisher, nibrt, abundance, thermo, bonds, sequence, relative, confident, bond, level, ptm, duo, identification, scientific, translational, intra, biopharmaceutical, minutes, demonstrate, digest, assays, reduced, coverage, atlscr, dyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssnfgtqtytcnvdhkpsntk, gpsvfplapcsr, lepedfavfycqqygsspr, lscaasgftfssyamswvr, stsestaalgclvk, tpevtcvvvdvshedpevqfnwyvdgvevhnak, smart, aedtavyycak, hkvyacevthqglsspvtk, gec, sgtasvvcllnnfypr, kits, wqqgnvfscsvmhealhnhytqk, nqvsltclvk, confirm, hinge, folding, confidence, protein

Confident peptide mapping and disulfide bond analysis of an IgG2 monoclonal antibodyAplikace | 2020 | Thermo Fischer ScientificInstrumentace
Proteomika, Klinická analýza
Thermo Fischer Scientific
Klíčová slova
interchain, disulfide, peptide, mapping, kccvecppcpappvagpsvflfppkpk, ptms, intrachain, kingfisher, nibrt, abundance, thermo, bonds, sequence, relative, confident, bond, level, ptm, duo, identification, scientific, translational, intra, biopharmaceutical, minutes, demonstrate, digest, assays, reduced, coverage, atlscr, dyfpepvtvswnsgaltsgvhtfpavlqssglyslssvvtvpssnfgtqtytcnvdhkpsntk, gpsvfplapcsr, lepedfavfycqqygsspr, lscaasgftfssyamswvr, stsestaalgclvk, tpevtcvvvdvshedpevqfnwyvdgvevhnak, smart, aedtavyycak, hkvyacevthqglsspvtk, gec, sgtasvvcllnnfypr, kits, wqqgnvfscsvmhealhnhytqk, nqvsltclvk, confirm, hinge, folding, confidence, protein


Mohlo by Vás zajímat


Brožury a specifikace
| 2021 | Waters

Peak Scientific Genius XE SMZ - User Manual

| 2021 | Peak Scientific
Generátory plynů
Peak Scientific

Peak Scientific Genius XE SMZ - Data sheet

Brožury a specifikace
| 2021 | Peak Scientific
Generátory plynů
Peak Scientific

Mohlo by Vás zajímat


Brožury a specifikace
| 2021 | Waters

Peak Scientific Genius XE SMZ - User Manual

| 2021 | Peak Scientific
Generátory plynů
Peak Scientific

Peak Scientific Genius XE SMZ - Data sheet

Brožury a specifikace
| 2021 | Peak Scientific
Generátory plynů
Peak Scientific
Další projekty
Sledujte nás
Další informace
WebinářeO násKontaktujte násPodmínky užití

LabRulez s.r.o. Všechna práva vyhrazena.