Capillary-flow LC-UV sample quality control for low-flow LC-MS based proteomics
Technické články | 2018 | Thermo Fisher ScientificInstrumentace
LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap
ZaměřeníProteomika
VýrobceThermo Fisher Scientific
Klíčová slovathermo, scientific, detergent, capillary, proteomics, screening, flow, digestion, pepswift, using, rslcnano, abundance, contamination, antibody, monolithic, sample, spray, easy, pierce, based, relative, digests, xcalibur, low, preconcentration, ddsksavylqmtdlrtedtgvyycsrnyygstydywgqgttltvssastkg, trap, switched, minutes, course, digest, institute, monoclonal, microtight, damage, impervious, suitability, column, commercially, line, available, source, fisher, mau, time, peptide, conditions, robustness, abc, sensitivity
Podobná PDF
PepSwift and ProSwift Monolithic capillary columns
2016|Thermo Fisher Scientific|Brožury a specifikace
C H R O M ATO G R A P H Y P rod u ct S p ecif ica t ions PepSwift and ProSwift Monolithic capillary columns Thermo Scientific™ PepSwift™ and ProSwift™ monolithic columns are specially designed for high-resolution…
Klíčová slova
pepswift, pepswiftproswift, proswiftminutes, minutesmonolithic, monolithicmonolith, monolithcolumns, columnsproteins, proteinsmau, mauprotein, proteinlysates, lysatescolumn, columncapillary, capillaryformats, formatsgelfree, gelfreeproteomics
Novel On-Line Multidimensional Low-Flow LCMS Setups for Comprehensive and Fast Proteome Profiling
2019|Thermo Fisher Scientific|Postery
Novel On-Line Multidimensional Low-Flow LCMS Setups for Comprehensive and Fast Proteome Profiling Oleksandr Boychenko; Christopher Pynn; Wim Decrop, Peter Jehle, Sylvia Grosse; Thermo Fisher Scientific, Germering, Germany VWD-3400RS NCS-3500RS The goal to achieve deeper proteome coverage requires longer analysis times…
Klíčová slova
fractionation, fractionationstamps, stampsproteome, proteomehpg, hpghigh, highdimension, dimensionapproach, approachframe, framemultidimensional, multidimensionallow, lowhram, hramprotein, proteinexactive, exactivenucleophosmin, nucleophosminnanolcms
Capillary-flow LC-MS: combining high sensitivity, robustness, and throughput
2017|Thermo Fisher Scientific|Technické články
TECHNICAL NOTE 72277 Capillary-flow LC-MS: combining high sensitivity, robustness, and throughput Authors Alexander Boychenko, Stephan Meding, Wim Decrop, Martin Ruehl, Remco Swart Thermo Fisher Scientific, Germering, Germany Keywords Capillary-flow LC-MS, capLC-MS, sensitivity, throughput, direct injection, preconcentration onto trap cartridge, robustness,…
Klíčová slova
caplc, caplcspray, spraypreconcentration, preconcentrationflow, flowtrap, traphpg, hpgcapillary, capillarypump, pumponto, ontosettings, settingscolumn, columneasy, easysource, sourceloading, loadingmerged
The Thermo Scientific Capillary Flow LC MS Solutions
|Thermo Fisher Scientific|Prezentace
The Thermo Scientific Capillary-Flow LC-MS Solutions The world leader in serving science Content • Thermo Scientific™ LC-MS front-end UHPLC portfolio • Advantages of CapLC-MS and Fields of Application • The Thermo Scientific™ CapLC-MS solution • Application Examples • Available Additional…
Klíčová slova
caplc, caplcthermo, thermoscientific, scientificloading, loadingdigest, digestpeptides, peptidescytochrome, cytochromeflow, flowhypersil, hypersilretention, retentionrslcnano, rslcnanodirect, directsignal, signaltrap, trappre
