vMethod™ Application for Food Testing
Aplikace | 2017 | SCIEXInstrumentace
LC/MS, LC/MS/MS, LC/QTRAP
ZaměřeníPotraviny a zemědělství
VýrobceSCIEX
Klíčová slovameat, sausage, halal, peptide, species, peptides, beef, signature, speciation, unique, lamb, food, cooked, protein, were, pork, chicken, raw, database, detection, vmethod, xxxxk, xxxxxr, xxxxxxxr, xxxxxxxxxxk, agela, proteinpilottm, shortlisted, samples, each, threshold, proteinpilot, ncbi, duck, defra, blast, defatted, incidences, minced, exionlc, cross, had, performed, processed, search, affairs, cycle, undeclared, products, fried
Podobná PDF
Cooked meat product analysis by LCMS/MS to determine between animal species using proteotypic peptide quantitative proteomic analysis
2015|Shimadzu|Postery
PO-CON1536E Cooked meat product analysis by LCMS/MS to determine between animal species using proteotypic peptide quantitative proteomic analysis ASMS 2015 WP 099 Alan J. Barnes1, Neil J. Loftus1, Junko Iida2 1 Shimadzu, Manchester, UK Shimadzu, Kyoto, Japan. 2 Cooked meat…
Klíčová slova
cooked, cookedproteotypic, proteotypichorse, horseanimal, animalmeat, meatproteomic, proteomicbeef, beefspecies, speciespeptide, peptidefood, foodhaché, hachélcms, lcmsmyosin, myosincollagen, collagensausage
Determination of Meat Authenticity Using a Comprehensive Targeted Proteomic Strategy and High-Resolution Mass Spectrometry
2016|Thermo Fisher Scientific|Aplikace
Complete method: Alberto Ruiz Orduna, Erik Husby, Charles T. Yang, Dipankar Ghosh & Francis Beaudry (2015): Assessment of meat authenticity using bioinformatics, targeted peptide biomarkers and high-resolution mass spectrometry, Food Additives & Contaminants: Part A, DOI: 10.1080/19440049.2015.1064173 Ap plica t…
Klíčová slova
lamb, lambpork, porkmeat, meatbeef, beefhorse, horsehaemoglobin, haemoglobinproteotypic, proteotypichpgdfgadaqgamtk, hpgdfgadaqgamtkhpsdfgadaqgamsk, hpsdfgadaqgamskhpgdfgadaqgamsk, hpgdfgadaqgamskhpsdfgadaqaamsk, hpsdfgadaqaamskmyoglobin, myoglobinspecies, speciesauthenticity, authenticitytryptic
Highly-Sensitive Detection of Multiple Porcine-Specific Peptides in Processed Foods by LC/MS/MS Method
2017|Shimadzu|Aplikace
Application News AD-0153 Halal Authentication Analysis / LCMS-8060 Highly-Sensitive Detection of Multiple Porcine-Specific Peptides in Processed Foods by LC/MS/MS Method Udi Jumhawan, Jie Xing & Zhaoqi Zhan Application Development & Support Centre, Shimadzu (Asia Pacific) Pte Ltd, Singapore Introduction…
Klíčová slova
lvvi, lvvipork, porkydii, ydiiporcine, porcinesala, salapeptide, peptidehalal, halalmarkers, markersfvie, fviespecific, specificpeptides, peptidesevte, evtetlaf, tlaftvlg, tvlgprocessed
Meat authentication and adulteration testing by HPLC combined with high-resolution, accurate-mass (HRAM) mass spectrometry
2019|Thermo Fisher Scientific|Aplikace
APPLICATION NOTE 65438 Meat authentication and adulteration testing by HPLC combined with high-resolution, accurate-mass (HRAM) mass spectrometry Authors Alberto Ruiz Orduna1, Charles T. Yang2, Dipankar Ghosh2, and Francis Beaudry1 Département de biomédecine vétérinaire, Faculté de médecine vétérinaire, Université de Montréal,…
Klíčová slova
meat, meatproteotypic, proteotypicadulteration, adulterationtargeted, targetedmass, masspork, porkpmf, pmfproteomic, proteomicpeptides, peptidesauthenticity, authenticityhpgdfgadaqgamtk, hpgdfgadaqgamtkhpsdfgadaqgamsk, hpsdfgadaqgamskunethical, unethicalhorse, horsehpgdfgadaqgamsk