Targeted assay for quantification of proteins from the SARSCoV- 2 coronavirus
Aplikace | 2020 | SCIEXInstrumentace
LC/MS, LC/MS/MS, LC/QQQ
ZaměřeníProteomika, Klinická analýza
VýrobceSCIEX
Klíčová slovanasopharyngeal, utm, assay, swabs, fmol, viral, peptide, proteins, llod, quantification, coronavirus, targeted, peptides, healthy, recombinant, pooled, dilution, lloq, researchers, mrm, series, nucleocapsid, infect, test, spiking, developed, detection, particle, from, were, viruses, capsid, two, typical, belongs, would, protein, translate, copies, lung, planned, skyline, mins, receptor, patient, prepared, humans, digests, protective, bioanalytical
Podobná PDF
Comprehending COVID-19: Maximizing LC-MS Detection Dynamic Range for Multiple Reaction Monitoring Based SARS-CoV-2 Analysis
2020|Waters|Aplikace
Application Note Comprehending COVID-19: Maximizing LC-MS Detection Dynamic Range for Multiple Reaction Monitoring Based SARS-CoV-2 Analysis Laurence Van Oudenhove, Jan Claereboudt, Rowan Moore, Hans Vissers, Bart Van Puyvelde, Simon Daled, Dieter Deforce, Katleen Van Uytfanghe, Steve Silvester, Sally Hannam, Donald…
Klíčová slova
mrm, mrmcov, covxevo, xevospike, spikepeptide, peptideacquity, acquitygupta, guptaleong, leongmasslynx, masslynxgeest, geestaverage, averageamount, amountresponse, responselevels, levelscoronavirus
A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2
2021|Thermo Fisher Scientific|Aplikace
TECHNICAL NOTE 000055 A quick and robust mass spectrometry-based method for the detection of SARS-CoV-2 Authors: Richard J. Gibson1, Stephanie N. Samra1, Kerry M. Hassell1, George A. Renney2, Bradley J. Hart1 1 Thermo Fisher Scientific, San Jose, CA, US 2…
Klíčová slova
aynvtqafgr, aynvtqafgradetqalpqr, adetqalpqrgwifgttldsk, gwifgttldskkadetqalpqr, kadetqalpqrnpannaaivlqlpqgttlpk, npannaaivlqlpqgttlpkdgiiwvategalntpk, dgiiwvategalntpkretention, retentionintensity, intensityfmol, fmolpeptide, peptideratio, ratiotime, timearea, areamin, minpeptides
LC-MS for detection of SARS-CoV-2 viral and host proteins
2021|Thermo Fisher Scientific|Aplikace
TECHNICAL NOTE 65974 LC-MS for detection of SARS-CoV-2 viral and host proteins Authors: Kruthi Suvarna1, Medha Gayathri J Pai1, Sanjeeva Srivastava1, Debadeep Bhattacharyya2, Kerry Hassell2 Indian Institute of Technology, Bombay, Powai, Mumbai, India 2 Thermo Fisher Scientific, San Jose, CA,…
Klíčová slova
severe, severeswab, swabviral, viralnasopharyngeal, nasopharyngealproteins, proteinshost, hostpeptide, peptideclinicians, clinicianstargeted, targetednstpgssr, nstpgssrfgg, fggsrm, srmdgiiwvategalntpk, dgiiwvategalntpkarea, areapeptides
Comprehending COVID-19: Application of UniSpray and Electrospray Ionization for the Detection of Proteolytic Digested SARS-CoV-2 Proteins
2020|Waters|Aplikace
Application Note Comprehending COVID-19: Application of UniSpray and Electrospray Ionization for the Detection of Proteolytic Digested SARSCoV-2 Proteins Stuart Oehrle, Laurence Van Oudenhove, Jan Claereboudt, Hans Vissers, Bart Van Puyvelde, Simon Daled, Katleen Van Uytfanghe, Dieter Deforce, Maarten Dhaenens For…
Klíčová slova
unispray, unisprayncap, ncappeptide, peptideelectrospray, electrospraypeptides, peptidesionization, ionizationutm, utmadetqalpqr, adetqalpqracquity, acquityxevo, xevouplc, uplctargetlynx, targetlynxplus, plusquartile, quartilemasslynx
