Analysis of Peptide/Protein*-Related Impurities Using the Integrated Solution of Bio 2D-LC/Q-TOF in Agilent MassHunter Software
Technické články | 2022 | Agilent TechnologiesInstrumentace
Analýza souvisejících nečistot peptidů a proteinů představuje klíčový úkol v oblasti farmaceutické a biotechnologické kvality. Složitost biologických vzorků i nízké hladiny modifikovaných forem (např. deamidace, truncační varianty) vyžadují vysokou separační sílu a citlivou detekci. Kombinace dvourozměrné kapalinové chromatografie (2D-LC) s hmotnostní spektrometrií (Q-TOF MS) výrazně zvyšuje možnost rozlišení i stopových složek, což zajišťuje spolehlivou identifikaci a kvantifikaci.
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS, 2D-LC
ZaměřeníFarmaceutická analýza
VýrobceAgilent Technologies
Souhrn
Význam tématu
Analýza souvisejících nečistot peptidů a proteinů představuje klíčový úkol v oblasti farmaceutické a biotechnologické kvality. Složitost biologických vzorků i nízké hladiny modifikovaných forem (např. deamidace, truncační varianty) vyžadují vysokou separační sílu a citlivou detekci. Kombinace dvourozměrné kapalinové chromatografie (2D-LC) s hmotnostní spektrometrií (Q-TOF MS) výrazně zvyšuje možnost rozlišení i stopových složek, což zajišťuje spolehlivou identifikaci a kvantifikaci.
Obsah byl automaticky vytvořen z originálního PDF dokumentu pomocí AI a může obsahovat nepřesnosti.
Podobná PDF
Advanced 2D-LC/MS Workflow for the Characterization of Semaglutide and Its Impurities
2025|Agilent Technologies|Aplikace
Application Note Biopharma/Pharma Advanced 2D-LC/MS Workflow for the Characterization of Semaglutide and Its Impurities Using an Agilent 1290 Infinity III bio 2D-LC and an Agilent 6545XT AdvanceBio LC/Q-TOF Authors Abstract Paramjeet Khandpur, Preeti Bharatiya, and Ashish Pargaonkar Agilent Technologies, Inc.…
Klíčová slova
semaglutide, semaglutidehaegtftsdvssylegqaakefiawlvrgrg, haegtftsdvssylegqaakefiawlvrgrgimpurities, impuritiespeptide, peptideaegtftsdvssylegqaakefiawlvrgrg, aegtftsdvssylegqaakefiawlvrgrgsequence, sequenceimpurity, impurityadvancebio, advancebiomass, massacquisition, acquisitionmodifications, modificationstruncated, truncatedpeptides, peptidesmhc, mhcseparation
High-Resolution Sampling 2D-LC for Pharmaceutical Impurity Analysis
2020|Agilent Technologies|Aplikace
High-Resolution Sampling 2D-LC for Pharmaceutical Impurity Analysis Detection of Impurities Hidden Under the API Peak at Relevant Levels Application Note Small Molecule Pharmaceuticals and Generics Authors Abstract Susanne Stephan and Sonja Krieger The analysis of impurities in low concentrations relative…
Klíčová slova
chlorodifluorobenzoic, chlorodifluorobenzoicdimension, dimensioninsulin, insulinwaste, wastehdr, hdrtime, timediverter, diverterdad, dadimpurities, impuritiesdiode, diodeimpurity, impuritycuts, cutssampling, samplingarray, arrayfirst
Simultaneous Impurity Analysis and Enantioseparation of Atenolol Using Achiral-Chiral 2D-LC
2022|Agilent Technologies|Aplikace
Application Note Pharma & Biopharma Simultaneous Impurity Analysis and Enantioseparation of Atenolol Using Achiral-Chiral 2D-LC Author Lucas Willmann Agilent Technologies, Inc. Abstract To ensure the quality of drug products, chromatographic separation of synthetic byproducts from active pharmaceutical ingredients (APIs), as…
Klíčová slova
atenolol, atenololimpurity, impuritychiral, chiralseparation, separationchromatographic, chromatographicenantioseparation, enantioseparationcut, cutphase, phasemhc, mhcimpurities, impuritieshypotensive, hypotensiveenantiomeric, enantiomericreversed, reversedopenlab, openlabcds
The Agilent InfinityLab 2D-LC Solution with Active Solvent Modulation
2018|Agilent Technologies|Technické články
Technical Overview The Agilent InfinityLab 2D-LC Solution with Active Solvent Modulation Achieving Improved Resolution and Sensitivity for Challenging Combinations of Separation Conditions Author Sonja Krieger Agilent Technologies, Inc. Abstract A major challenge during method development in two-dimensional liquid chromatography (2D-LC)…
Klíčová slova
asm, asmdeck, deckrplc, rplcbreakthrough, breakthroughfocusing, focusinggradient, gradientsolvent, solventcolumn, columneclipse, eclipsedimensional, dimensionalcapillaries, capillarieszorbax, zorbaxmodulation, modulationpeptides, peptidespartial
