A multiplex targeted Mass spectrometry approach for the quantification of synuclein proteoforms in human biological fluids
Postery | 2020 | ShimadzuInstrumentace
LC/MS, LC/MS/MS, LC/QQQ
ZaměřeníProteomika
VýrobceShimadzu
Klíčová slovasynuclein, proteotypic, peptide, alpha, immunocapture, csf, hemoglobin, multiplex, targeted, agsiaaatgfvkkdqlgkneegapqegiledmpvdpdneayemp, anytical, egvlyvgsk, egvvaaaek, egvvgavek, egvvhgvatvaek, egvvqgvasvaek, envvqsvtsvaek, eqanavseavvssvntvatk, eqashlggavfsgagniaaatglvk, eqvtnvggavvtgvtavaqk, kenvvqsvtsvaektkeqanavseavvssvntvatktveeaeniav, mdvfkkgfsiakegvvgavektkqgvteaaektkegvmyvgakt, mdvfmk, mdvfmkglskakegvvaaaektkqgvaeaagktkegvlyvg, mdvfmkglsmakegvvaaaektkqgvteaaektkegvlyvgskt, ptdlkpeevaqeaaeeplieplmepegesyedppqeeyqeyepea, qgvaeaagk, qgvteaaek, regvvqgvasvaektkeqashlggavfsgagniaaatglvkreef, seegyqdyepea, sktkegvvhgvatvaektkeqvtnvggavvtgvtavaqktveg, synculein, tsgvvrkedlrpsapqqegeaskekeevaeeaqsggd, tveeaeniavtsgvvr, tvegagsiaaatgfvk, tyfphfdlshgsaqvk, mrm, beta, intensively, biological, mikros, sequence, ter, proteoforms, approach, brain, developed, aggregates, fluids, gamma
Podobná PDF
Development of a multiplex ultra-sensitive LC-MS method for the quantification of Alzheimer's disease main blood biomarkers (pTau,Tau, APOE, Aβ, 𝜶-synuclein) : a challenge
2023|Agilent Technologies|Postery
WP-053 Development of a multiplex ultra-sensitive LC-MS method for the quantification of Alzheimer's disease main blood biomarkers (pTau,Tau, APOE, Aβ, 𝜶-synuclein) : a challenge Florine Leipp1,2, Jérôme Vialaret2, Doriane Toinon3, Ann-Christin Niehoff4, Sylvain Lehmann2 and Christophe Hirtz2 1. Shimadzu France…
Klíčová slova
detected, detectedalzheimer, alzheimerimmunocapture, immunocapturecapture, captureantibody, antibodytau, tauphosphorylation, phosphorylationphosphorylated, phosphorylatedtargeting, targetingdevelopment, developmentptau, ptauproject, projectdisease, diseasesites, sitessynuclein
Quantification of Host Cell Protein Impurities Using the Agilent 1290 Infinity II LC Coupled with the 6495B Triple Quadrupole LC/MS System
2018|Agilent Technologies|Aplikace
Application Note Biotherapeutics Quantification of Host Cell Protein Impurities Using the Agilent 1290 Infinity II LC Coupled with the 6495B Triple Quadrupole LC/MS System Authors Linfeng Wu and Yanan Yang Agilent Technologies, Inc. Santa Clara, CA, USA Introduction Host Cell…
Klíčová slova
protein, proteinsil, silpeptide, peptideskyline, skylinecounts, countstargeted, targetedamol, amolassaymap, assaymaphcp, hcppeptides, peptidesquantification, quantificationvfdviir, vfdviirdpgvldr, dpgvldrllleyleek, llleyleekbravo
A Semi Quantitative Method for the Analysis of Tryptic Peptides in Human Serum: A Rapid, Targeted UPLC-MS/MS Approach Using Biognosys Plasma Dive Kit
2018|Waters|Aplikace
[ APPLICATION NOTE ] A Semi Quantitative Method for the Analysis of Tryptic Peptides in Human Serum: A Rapid, Targeted UPLC-MS/MS Approach Using Biognosys Plasma Dive Kit Billy Joe Molloy Waters Corporation, Wilmslow, UK APPLICATION BENEFITS ■■ ■■ Targeted, semi-quantitative…
Klíčová slova
apolipoprotein, apolipoproteinfactor, factorcoagulation, coagulationkallikrein, kallikreinchain, chainkallistatin, kallistatinbinding, bindinguplc, uplcinhibitor, inhibitorsubunit, subunitxiii, xiiifibrinogen, fibrinogenhaptoglobin, haptoglobinproteins, proteinsglobulin
A Semi Quantitative Method for the Analysis of Tryptic Peptides in Human Serum: A Rapid, Targeted UPLC-MS/MS Approach Using Biognosys Plasma Dive Kit
2018|Waters|Aplikace
[ APPLICATION NOTE ] A Semi Quantitative Method for the Analysis of Tryptic Peptides in Human Serum: A Rapid, Targeted UPLC-MS/MS Approach Using Biognosys Plasma Dive Kit Billy Joe Molloy Waters Corporation, Wilmslow, UK APPLICATION BENEFITS ■■ ■■ Targeted, semi-quantitative…
Klíčová slova
apolipoprotein, apolipoproteinfactor, factorcoagulation, coagulationkallikrein, kallikreinchain, chainkallistatin, kallistatinbinding, bindinguplc, uplcinhibitor, inhibitorsubunit, subunitxiii, xiiifibrinogen, fibrinogenhaptoglobin, haptoglobinproteins, proteinsglobulin
