Comparing an intrinsically disordered protein α-synuclein to fixed structure proteins following FPOP modification using high resolution LCMS intact analysis
Postery | 2020 | ShimadzuInstrumentace
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
ZaměřeníProteomika
VýrobceShimadzu
Klíčová slovafpop, idps, proteins, error, oxidative, oxidatively, fixed, synuclein, idp, protein, mass, deconvoluted, myoglobin, oxidation, modification, structure, lcms, intact, modified, evidence, lactoglobulin, intrinsically, photochemical, horse, theoretical, modify, ault, busuttil, goodfellow, gtvvltalggilkkkghheaelkplaqshatkh, kipikylefisdaiihvlhskhpgdfgadaqgam, lftghpetlekfdkfkhlkteaemkasedlkkh, sobott, tkalelfrndiaakykelgfqg, glsdgewqqvlnvwgkveadiaghgqevlir, lewy, hram, jake, play, microsecond, growing, native, barnes, aeris, deconvolution, enabling, disordered, loftus, role, fast
Podobná PDF
Identification of Oxidation Sites on a Monoclonal Antibody Using an Agilent 1260 Infinity HPLC-Chip/MS System Coupled to an Accurate-Mass 6520 Q-TOF LC/MS
2011|Agilent Technologies|Aplikace
Identification of Oxidation Sites on a Monoclonal Antibody Using an Agilent 1260 Infinity HPLC-Chip/MS System Coupled to an Accurate-Mass 6520 Q-TOF LC/MS Application Note Authors Abstract Ravindra Gudihal Agilent Technologies India Pvt. Ltd. Bangalore, India The identification of oxidation sites…
Klíčová slova
mab, maboxidized, oxidizedoxidation, oxidationntlylq, ntlylqsslr, sslrpeptide, peptidetrypsin, trypsinmonoclonal, monoclonalmass, masstheoretical, theoreticalmsslr, msslrntlylqmsslr, ntlylqmsslrbioconfirm, bioconfirmantibody, antibodysequence
Top Down Milk Protein Identification and Relative Quantification by Q Exactive Mass Spectrometer
2013|Thermo Fisher Scientific|Postery
Top Down Milk Protein Identification and Relative Quantification by Q Exactive Mass Spectrometer Terry Zhang, David M. Horn, Charles Yang and Dipankar Ghosh Thermo Fisher Scientific, San Jose CA Overview Purpose: Mixtures of casein and whey proteins were characterized by…
Klíčová slova
casein, caseinwhey, wheyrylations, rylationsprotein, proteinforms, formsrylation, rylationproteins, proteinsprosightpc, prosightpclactalbumin, lactalbuminsequence, sequencetruncation, truncationsubstantial, substantialons, onsmass, massidentified
Analysis of Proteins and Peptides using LC-MS
|Shimadzu|Aplikace
LAAN-A-LM-E012 SHIMADZU APPLICATION NEWS ● LIQUID CHROMATOGRAPHY MASS SPECTROMETRY No. C55 Analysis of Proteins and Peptides using LC-MS important process, and this is currently conducted using such technologies as peptide sequencing for amino acid analysis, HPLC for simple peptide mapping,…
Klíčová slova
cdl, cdlweight, weightvoltage, voltagemolecular, molecularmultiply, multiplyamino, aminopeptides, peptidesmass, massnews, newspeptide, peptidesequence, sequenceenzymatic, enzymaticylefisdaiihvlhskhpgdfgadaqgamtk, ylefisdaiihvlhskhpgdfgadaqgamtkglsdgewqqvlnvwgkveadiaghgqevlir, glsdgewqqvlnvwgkveadiaghgqevlirusing
Protein Confirmation Using the LC/MSD TOF and the Agilent TOF Protein Confirmation Software
2004|Agilent Technologies|Aplikace
Protein Confirmation Using the LC/MSD TOF and the Agilent TOF Protein Confirmation Software Application Note Donghui Yi, Irene Lee, and John Fjeldsted Agilent Technologies Introduction The combination of liquid chromatography, elec- molecular weight is further complicated by the trospray ionization,…
Klíčová slova
protein, proteinconfirmation, confirmationtof, tofweights, weightsagilent, agilentmsd, msdmolecular, molecularcytochrome, cytochrometechnologies, technologiesdeconvolution, deconvolutionsoftware, softwaremultiply, multiplyproteins, proteinsautomated, automatedinteractive
