Use of a MAbPac RP capillary column to monitor glycosylation site occupancy in therapeutics
Aplikace | 2020 | Thermo Fisher ScientificInstrumentace
Spotřební materiál, LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap, LC kolony
ZaměřeníProteomika
VýrobceThermo Fisher Scientific
Klíčová slovaoccupancy, xic, glycosylation, site, eeqydstyr, heavy, glycosylated, eeqynstyr, peptide, min, mabpac, time, deamidation, mabs, light, trastuzumab, capillary, clone, tryptic, chain, peptides, fab, rituximab, therapeutic, mab, unglycosylated, early, were, asparagine, thermo, deglycosylated, digest, mapping, smart, column, drug, format, pngase, xics, nanoviper, full, digests, attribute, aspartic, trypsin, optimization, asqdvdtavawyqqkpgk, carboxyethyl, glewvaiadasgtr, glewvsaidasgtr
Podobná PDF
Disulfide Bond and Glycosylation Site Occupancy Mapping of Trastuzumab Using a Novel Capillary MAbPac RP Column
2020|Thermo Fisher Scientific|Postery
Disulfide Bond and Glycosylation Site Occupancy Mapping of Trastuzumab Using a Novel Capillary MAbPac RP Column Zoltan Szabo1, Xuefei Sun1, Brandon Robson1, Mike Baynham2 and Shanhua Lin1 1Thermo Fisher Scientific, Sunnyvale, USA, 2Thermo Fisher Scientific, Runcorn, UK ABSTRACT RESULTS Purpose:…
Klíčová slova
disulfide, disulfidepeptide, peptidetrastuzumab, trastuzumabglycosylation, glycosylationvtitcr, vtitcrbond, bondaedtavyycsr, aedtavyycsrsgtdftltisslqpedfatyycqqhyttpptfgqgtk, sgtdftltisslqpedfatyycqqhyttpptfgqgtkoriginally, originallyheavy, heavyaspartic, asparticasparagine, asparaginesgtasvvcllnnfypr, sgtasvvcllnnfyprthtcppcpapellggpsvflfppkpk, thtcppcpapellggpsvflfppkpknqvsltclvk
An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies
2018|Thermo Fisher Scientific|Aplikace
APPLICATION NOTE 21835 An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Giorgio Oliviero, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing…
Klíčová slova
chain, chainheavy, heavyeeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrmnslqsndtaiyycar, mnslqsndtaiyycarlight, lightcetuximab, cetuximabkingfisher, kingfisherwqqgnvfscsvmhealhnhytqk, wqqgnvfscsvmhealhnhytqksmart, smartdigest, digestprime, primeduo, duomagnetic, magneticadalimumab
Investigating process-related post-translational modifications in NISTmAb RM 8671 using high-throughput peptide mapping analysis
2018|Thermo Fisher Scientific|Aplikace
APPLICATION NOTE 21781 Investigating process-related post-translational modifications in NISTmAb RM 8671 using high-throughput peptide mapping analysis Authors Silvia Millán, Craig Jakes, Noemí Dorival, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing Research and…
Klíčová slova
eeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrpeptide, peptidesmart, smartdigestion, digestionsequence, sequencemodifications, modificationsrelative, relativemapping, mappingscientific, scientificterminal, terminaldigest, digestptms, ptmsoptima, optimaabundance
SMART Digest Peptide Mapping and Quantitation Compendium
2018|Thermo Fisher Scientific|Příručky
Table of Contents Introduction Faster and More Sensitive Protein Characterization and Quantitation Easier Digestion Faster Digestion Highly Reproducible Digestion Automation of Digestion Improving Sensitivity and Speed SMART Digest Peptide Mapping and Quantitation Compendium Peptide Mapping Peptide Quantitation Product and Method…
Klíčová slova
mapping, mappingpeptide, peptidedigestion, digestionsmart, smartmodifications, modificationsdigest, digestchain, chainposttranslational, posttranslationalheavy, heavymonoclonal, monoclonalantibodies, antibodiestrypsin, trypsinprotein, proteinthroughput, throughputautomated