LCMS
Další informace
WebinářeO násKontaktujte násPodmínky užití
LabRulez s.r.o. Všechna práva vyhrazena. Obsah dostupný pod licencí CC BY-SA 4.0 Uveďte původ-Zachovejte licenci.

Use of a MAbPac RP capillary column to monitor glycosylation site occupancy in therapeutics

Aplikace | 2020 | Thermo Fisher ScientificInstrumentace
Spotřební materiál, LC/HRMS, LC/MS, LC/MS/MS, LC/Orbitrap, LC kolony
Zaměření
Proteomika
Výrobce
Thermo Fisher Scientific
Klíčová slova
PDF verze ke stažení a čtení
 

Podobná PDF

Toggle
Disulfide Bond and Glycosylation Site Occupancy Mapping of Trastuzumab Using a Novel Capillary MAbPac RP Column Zoltan Szabo1, Xuefei Sun1, Brandon Robson1, Mike Baynham2 and Shanhua Lin1 1Thermo Fisher Scientific, Sunnyvale, USA, 2Thermo Fisher Scientific, Runcorn, UK ABSTRACT RESULTS Purpose:…
Klíčová slova
disulfide, disulfidepeptide, peptidetrastuzumab, trastuzumabglycosylation, glycosylationvtitcr, vtitcrbond, bondaedtavyycsr, aedtavyycsrsgtdftltisslqpedfatyycqqhyttpptfgqgtk, sgtdftltisslqpedfatyycqqhyttpptfgqgtkoriginally, originallyheavy, heavyaspartic, asparticasparagine, asparaginesgtasvvcllnnfypr, sgtasvvcllnnfyprthtcppcpapellggpsvflfppkpk, thtcppcpapellggpsvflfppkpknqvsltclvk
APPLICATION NOTE 21835 An automated high-throughput workflow for peptide mapping to monitor post-translational modifications (PTMs) of monoclonal antibodies Authors Silvia Millán-Martín, Craig Jakes, Giorgio Oliviero, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing…
Klíčová slova
chain, chainheavy, heavyeeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrmnslqsndtaiyycar, mnslqsndtaiyycarlight, lightcetuximab, cetuximabkingfisher, kingfisherwqqgnvfscsvmhealhnhytqk, wqqgnvfscsvmhealhnhytqksmart, smartdigest, digestduo, duoprime, primemagnetic, magneticadalimumab
APPLICATION NOTE 21781 Investigating process-related post-translational modifications in NISTmAb RM 8671 using high-throughput peptide mapping analysis Authors Silvia Millán, Craig Jakes, Noemí Dorival, Sara Carillo, Jonathan Bones Characterisation and Comparability Laboratory, NIBRT – The National Institute for Bioprocessing Research and…
Klíčová slova
eeqynstyr, eeqynstyrtkpreeqynstyr, tkpreeqynstyrpeptide, peptidesmart, smartdigestion, digestionsequence, sequencemodifications, modificationsrelative, relativemapping, mappingscientific, scientificterminal, terminaldigest, digestptms, ptmsoptima, optimaabundance
SMART Digest Peptide Mapping and Quantitation Compendium
2018|Thermo Fisher Scientific|Příručky
Table of Contents Introduction Faster and More Sensitive Protein Characterization and Quantitation Easier Digestion Faster Digestion Highly Reproducible Digestion Automation of Digestion Improving Sensitivity and Speed SMART Digest Peptide Mapping and Quantitation Compendium Peptide Mapping Peptide Quantitation Product and Method…
Klíčová slova
mapping, mappingpeptide, peptidedigestion, digestionsmart, smartmodifications, modificationsdigest, digestchain, chainposttranslational, posttranslationalheavy, heavymonoclonal, monoclonaltrypsin, trypsinantibodies, antibodiesthroughput, throughputprotein, proteinautomated
Další projekty
Sledujte nás
Další informace
WebinářeO násKontaktujte násPodmínky užití
LabRulez s.r.o. Všechna práva vyhrazena. Obsah dostupný pod licencí CC BY-SA 4.0 Uveďte původ-Zachovejte licenci.