A systematic investigation of CID Q-TOF-MS/MS collision energies
Technické články | 2017 | BrukerInstrumentace
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
ZaměřeníKlinická analýza
VýrobceBruker
Klíčová slovaglycopeptide, glycan, collision, glycopeptides, moiety, energy, energies, peptide, evfvhpnysk, investigation, optima, immunoglobulins, systematic, optimum, tof, score, knowledge, acetylglucosamine, cid, identification, synthetic, digests, bruker, inensity, slak, vptaqpqaeg, tryptic, proteinscape, eptide, glycoquest, individ, digest, bioinformatic, ual, theoretical, ano, suggestion, mention, onset, dependency, intensity, fetuin, rarely, mixture, frag, moieties, spectrum, protein, progression, systematically
Podobná PDF
New Classification Workflow for N-Glycopeptides using Bruker oTOF Instruments and the Glycopeptide Instant Expertise™ Acquisition Method
2017|Bruker|Aplikace
New Classification Workflow for N-Glycopeptides using Bruker oTOF Instruments and the Glycopeptide Instant Expertise™ Acquisition Method Mass spectrometry has become the method of choice for glycopeptide characterization. Beside the instrumental setup an appropriate software solution is necessary to support glycopeptide…
Klíčová slova
glycopeptide, glycopeptidepeptide, peptideglycan, glycanclassification, classificationmoiety, moietyglycopeptides, glycopeptidesfragmentation, fragmentationproteinscape, proteinscapeinstant, instantexpertise, expertiseoxonium, oxoniumworkflow, workflowbruker, brukerenergies, energiesotof
How to Determine Glycan Profiles of Biopharmaceuticals from Peptide Mapping Data
2021|Bruker|Aplikace
How to Determine Glycan Profiles of Biopharmaceuticals from Peptide Mapping Data A new and sensitive approach combining BioPharma Compass, PASEF and VIP-HESI Abstract Glycosylation is a common critical quality attribute (CQA) of therapeutic proteins and needs to be characterized during…
Klíčová slova
glycan, glycanpeptide, peptideglycopeptide, glycopeptidetryptic, trypticcompositions, compositionsmapping, mappingsearch, searchpasef, paseftimstof, timstofbruker, brukerglycans, glycansglycopeptides, glycopeptidesspectra, spectrausing, usingwere
Peptide Mapping of Tryptic Digests for mAbs using a novel ECD cell on the 6545XT AdvanceBio LC/Q-TOF Mass Spectrometer
2024|Agilent Technologies|Postery
Poster Reprint ASMS 2024 Poster number MP 665 Peptide Mapping of Tryptic Digests for mAbs using a novel ECD cell on the 6545XT AdvanceBio LC/Q-TOF Mass Spectrometer Stephen Sciuto1, Maozi Liu1, Rachel Franklin2, Jerry Han1 1Agilent Technologies, Inc., Santa Clara,…
Klíčová slova
tryptic, trypticglycopeptide, glycopeptidetkpreeqynstyrvvsvltvlhqdwlngk, tkpreeqynstyrvvsvltvlhqdwlngkptms, ptmsdigests, digestsexd, exddissociation, dissociationfragment, fragmenttrastuzumab, trastuzumabpeptide, peptidemabs, mabscid, cidsheath, sheathhexnac, hexnacgas
Enhanced Glycopeptide Identification Using the SYNAPT XS Q-ToF with Ion Mobility Enabled Wideband Enhancement
2020|Waters|Aplikace
[ TECHNOLOGY BRIEF ] Enhanced Glycopeptide Identification Using the SYNAPT XS Q-ToF with Ion Mobility Enabled Wideband Enhancement Christopher J. Hughes,¹ Sakari Joenväärä,² Robert S. Plumb,³ Lee A. Gethings,¹ and Risto Renkonen⁴ ¹Waters Corporation, Wilmslow, UK; ²Haartman Institute, University of…
Klíčová slova
wideband, widebandenhancement, enhancementsynapt, synaptsingly, singlymobility, mobilitycharged, chargedglycopeptide, glycopeptidebrief, briefions, ionsglycopeptides, glycopeptidesobserved, observedenabled, enabledtof, toftechnology, technologyion
