LCMS
Další informace
WebinářeO násKontaktujte násPodmínky užití
LabRulez s.r.o. Všechna práva vyhrazena. Obsah dostupný pod licencí CC BY-SA 4.0 Uveďte původ-Zachovejte licenci.

Unambiguous di-sulphide bond assignment in synthetic peptides Linaclotide and Plecanatide using Agilent 6546/6550 LC-QTOF High Resolution Mass Spectrometer

 

Podobná PDF

Toggle
Agilent ASMS 2020 Posters Book
2020|Agilent Technologies|Postery
Poster Reprint ASMS 2020 MP 176 Using ICP-MS/MS with M-Lens for the analysis of high silicon matrix samples Yu Ying1; Xiangcheng Zeng1 1Agilent China Technologies, China, Shanghai, Introduction The expansion of the connected devices and the Internet of Things (IoT)…
Klíčová slova
peptide, peptidereprint, reprintwere, wereposter, postermethod, methoddiscussion, discussionpositive, positiveresults, resultsclassification, classificationboth, bothusing, usingexperimental, experimentalanalysis, analysisrecovery, recoverysample
Poster Note 64 8 0 8 Disulfide Bond Identification of Biotherapeutic Proteins Using Various Fragmentation Techniques Available on an Orbitrap Fusion Tribrid Mass Spectrometer Disulfide Disulfide bond bond identification identification of of biotherapeutic biotherapeutic prot prot Fusion Fusion Tribrid Tribrid…
Klíčová slova
disulfide, disulfidehcd, hcdreduced, reduceddependent, dependentfragmentation, fragmentationdisu, disuests, estsdis, disavailab, availabdata, databond, bondtribrid, tribridacquisition, acquisitionfusion, fusionbiotherapeutic
APPLICATION NOTE 21688 Robust and reproducible peptide mapping and intact mass analysis workflows on a single instrument platform Authors Amy Farrell , Kai Scheffler , Ken Cook 2, Martin Samonig2, David Munoz2, Alexander Schwahn2, and Jonathan Bones1 1 Characterisation and…
Klíčová slova
somatotropin, somatotropinpeptide, peptidedigestion, digestionpeptides, peptidesdisulfide, disulfidecleavage, cleavageprotein, proteinmissed, missednative, nativesequence, sequencemapping, mappingmodifications, modificationsdigest, digestdeamidation, deamidationintact
Automatic Protein Disulfide Bond Mapping of a Monoclonal Antibody Using the Agilent Accurate-Mass Q-TOF LC/MS Platform and BioConfirm Software Algorithm Application Note Biotherapeutics and Biosimilars Authors Introduction David L. Wong, Stephen Madden, and Monoclonal antibodies (mAbs) are a very important…
Klíčová slova
disulfide, disulfidelysc, lysctrypsin, trypsinscore, scorebond, bondbonds, bondslinkages, linkagesherceptin, herceptinmapping, mappingthtcppcpapellggpsvflfppk, thtcppcpapellggpsvflfppkpeptides, peptidescounts, countsaedtavyycsr, aedtavyycsrnonreduced, nonreducedlscaasgfnik
Další projekty
Sledujte nás
Další informace
WebinářeO násKontaktujte násPodmínky užití
LabRulez s.r.o. Všechna práva vyhrazena. Obsah dostupný pod licencí CC BY-SA 4.0 Uveďte původ-Zachovejte licenci.