Unambiguous di-sulphide bond assignment in synthetic peptides Linaclotide and Plecanatide using Agilent 6546/6550 LC-QTOF High Resolution Mass Spectrometer
Postery | 2020 | Agilent TechnologiesInstrumentace
LC/TOF, LC/HRMS, LC/MS, LC/MS/MS
ZaměřeníProteomika
VýrobceAgilent Technologies
Klíčová slovasulphide, plecanatide, linaclotide, cyanylated, peptides, bond, disulphide, bridges, linkages, tcep, peptide, were, sequence, cceyccnpactgcy, cdap, ndecelcvnvactgcl, obtanined, partial, confirmed, cysteines, confirmation, cleaved, discussion, reduced, linkage, resultant, fractionated, mass, unambiguous, signature, however, reprint, bonds, locations, infinity, fractionation, assignment, synthesis, fractions, differential, spectrometric, binding, results, poster, optimizing, native, involved, experimental, functionality, using
Podobná PDF
Agilent ASMS 2020 Posters Book
2020|Agilent Technologies|Postery
Poster Reprint ASMS 2020 MP 176 Using ICP-MS/MS with M-Lens for the analysis of high silicon matrix samples Yu Ying1; Xiangcheng Zeng1 1Agilent China Technologies, China, Shanghai, Introduction The expansion of the connected devices and the Internet of Things (IoT)…
Klíčová slova
peptide, peptidereprint, reprintwere, wereposter, postermethod, methoddiscussion, discussionpositive, positiveresults, resultsclassification, classificationboth, bothusing, usingexperimental, experimentalanalysis, analysisrecovery, recoverysample
Disulfide Bond Identification of Biotherapeutic Proteins Using Various Fragmentation Techniques Available on an Orbitrap Fusion Tribrid Mass Spectrometer
2016|Thermo Fisher Scientific|Postery
Poster Note 64 8 0 8 Disulfide Bond Identification of Biotherapeutic Proteins Using Various Fragmentation Techniques Available on an Orbitrap Fusion Tribrid Mass Spectrometer Disulfide Disulfide bond bond identification identification of of biotherapeutic biotherapeutic prot prot Fusion Fusion Tribrid Tribrid…
Klíčová slova
disulfide, disulfidehcd, hcdreduced, reducedfragmentation, fragmentationdependent, dependentdisu, disuests, estsdis, disavailab, availabdata, databond, bondtribrid, tribridfusion, fusionacquisition, acquisitionbiotherapeutic
Robust and reproducible peptide mapping and intact mass analysis workflows on a single instrument platform
2017|Thermo Fisher Scientific|Aplikace
APPLICATION NOTE 21688 Robust and reproducible peptide mapping and intact mass analysis workflows on a single instrument platform Authors Amy Farrell , Kai Scheffler , Ken Cook 2, Martin Samonig2, David Munoz2, Alexander Schwahn2, and Jonathan Bones1 1 Characterisation and…
Klíčová slova
somatotropin, somatotropinpeptide, peptidedigestion, digestionpeptides, peptidesdisulfide, disulfidecleavage, cleavageprotein, proteinmissed, missednative, nativesequence, sequencemapping, mappingmodifications, modificationsdigest, digestdeamidation, deamidationabundance
Automatic Protein Disulfide Bond Mapping of a Monoclonal Antibody Using the Agilent Accurate-Mass Q-TOF LC/MS Platform and BioConfirm Software Algorithm
2016|Agilent Technologies|Aplikace
Automatic Protein Disulfide Bond Mapping of a Monoclonal Antibody Using the Agilent Accurate-Mass Q-TOF LC/MS Platform and BioConfirm Software Algorithm Application Note Biotherapeutics and Biosimilars Authors Introduction David L. Wong, Stephen Madden, and Monoclonal antibodies (mAbs) are a very important…
Klíčová slova
disulfide, disulfidelysc, lysctrypsin, trypsinscore, scorebond, bondbonds, bondslinkages, linkagesherceptin, herceptinmapping, mappingthtcppcpapellggpsvflfppk, thtcppcpapellggpsvflfppkpeptides, peptidescounts, countsaedtavyycsr, aedtavyycsrnonreduced, nonreducedlscaasgfnik
