Obnova hesla
Obnova hesla

Analysis of Proteins and Peptides using LC-MSAplikace | | ShimadzuInstrumentace
Klíčová slova
cdl, weight, voltage, molecular, amino, peptides, multiply, peptide, news, sequence, enzymatic, mass, ylefisdaiihvlhskhpgdfgadaqgamtk, digestion, charged, glsdgewqqvlnvwgkveadiaghgqevlir, array, using, tpck, theoretical, conducted, acid, proteins, state, produced, composition, detergents, protein, novo, analysis, horse, effective, singly, myoglobin, calculated, proves, detected, edited, from, sequencing, medicines, distinguished, recombinant, enzymes, mobile, structurally, expression, quadrupole, ionized, spectrometer

Analysis of Proteins and Peptides using LC-MSAplikace | | ShimadzuInstrumentace
Klíčová slova
cdl, weight, voltage, molecular, amino, peptides, multiply, peptide, news, sequence, enzymatic, mass, ylefisdaiihvlhskhpgdfgadaqgamtk, digestion, charged, glsdgewqqvlnvwgkveadiaghgqevlir, array, using, tpck, theoretical, conducted, acid, proteins, state, produced, composition, detergents, protein, novo, analysis, horse, effective, singly, myoglobin, calculated, proves, detected, edited, from, sequencing, medicines, distinguished, recombinant, enzymes, mobile, structurally, expression, quadrupole, ionized, spectrometer


Mohlo by Vás zajímat

Development of a Method for Multipesticide Analysis Using the Agilent 1260 Infinity Analytical SFC System with Triple Quadrupole MS Detection

| 2017 | Agilent Technologies
Agilent Technologies
Potraviny a zemědělství

Improving Drug Metabolite Identification in Biofluids with the ACQUITY PREMIER and Hybrid Organic Surface Technology: Increased Sensitivity and Reproducibility

| 2021 | Waters
Klinická analýza

Analysis of Kakkonto by Nexera-e and SPD-M30A Photodiode Array Detector (Part 1)

| 2015 | Shimadzu
Farmaceutická analýza

Mohlo by Vás zajímat

Development of a Method for Multipesticide Analysis Using the Agilent 1260 Infinity Analytical SFC System with Triple Quadrupole MS Detection

| 2017 | Agilent Technologies
Agilent Technologies
Potraviny a zemědělství

Improving Drug Metabolite Identification in Biofluids with the ACQUITY PREMIER and Hybrid Organic Surface Technology: Increased Sensitivity and Reproducibility

| 2021 | Waters
Klinická analýza

Analysis of Kakkonto by Nexera-e and SPD-M30A Photodiode Array Detector (Part 1)

| 2015 | Shimadzu
Farmaceutická analýza
Další projekty
Sledujte nás
Další informace
WebinářeO násKontaktujte násPodmínky užití

LabRulez s.r.o. Všechna práva vyhrazena.